PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB06G22200.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family M-type_MADS
Protein Properties Length: 81aa    MW: 9064.41 Da    PI: 10.5171
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB06G22200.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF86.61.4e-271059251
                  ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
        SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                  rie+++ rqvtfskRr g++KKA+EL +LCda+v v++fsstg+ly+yss
  OB06G22200.1 10 RIEDTTSRQVTFSKRRSGLFKKAKELAILCDAQVGVLVFSSTGRLYDYSS 59
                  8***********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006629.45161IPR002100Transcription factor, MADS-box
SMARTSM004321.4E-36160IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
CDDcd002653.45E-34371No hitNo description
SuperFamilySSF554551.31E-28376IPR002100Transcription factor, MADS-box
PRINTSPR004042.0E-26323IPR002100Transcription factor, MADS-box
PfamPF003191.9E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004042.0E-262338IPR002100Transcription factor, MADS-box
PRINTSPR004042.0E-263859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007584Biological Processresponse to nutrient
GO:0010167Biological Processresponse to nitrate
GO:0048527Biological Processlateral root development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0008134Molecular Functiontranscription factor binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 81 aa     Download sequence    Send to blast
MVRGKTVIRR IEDTTSRQVT FSKRRSGLFK KAKELAILCD AQVGVLVFSS TGRLYDYSSS  60
SPSINIVTKY MGSTSFSYDI N
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P1e-15160160Myocyte-specific enhancer factor 2B
1tqe_Q1e-15160160Myocyte-specific enhancer factor 2B
1tqe_R1e-15160160Myocyte-specific enhancer factor 2B
1tqe_S1e-15160160Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0056461e-63AP005646.2 Oryza sativa Japonica Group genomic DNA, chromosome 6, BAC clone:B1077E08.
GenBankAP0149621e-63AP014962.1 Oryza sativa Japonica Group DNA, chromosome 6, cultivar: Nipponbare, complete sequence.
GenBankCP0126141e-63CP012614.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 6 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015641671.18e-34PREDICTED: MADS-box transcription factor 23-like
RefseqXP_015641670.18e-34PREDICTED: MADS-box transcription factor 23-like
SwissprotQ9SI385e-31ANR1_ARATH; MADS-box transcription factor ANR1
TrEMBLJ3MDX62e-52J3MDX6_ORYBR; Uncharacterized protein
STRINGOB06G22200.14e-52(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP12938398
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G14210.13e-32AGAMOUS-like 44